 Catalog Products |
|
| ADP-Ribosylation Factors (ARF) | | | Adrenomedullin Peptides | | | Agouti Related Peptides | | | Amylin Peptides | | | Amyloid Peptides | | | Angiotensins and Related Peptides | | | Annexin | | | Anti-Inflammatory Peptides | | | Antimicrobial and Related Peptides | | | Antioxidant Peptides | | | Apelin Peptides | | | Apolipoprotein Peptides | | | Apoptosis Peptides | | | Arg-Phe-Amide RFamide Related Peptides | | | Bacterial Peptides | | | Basic Fibroblast Growth Factor (bFGF) | | | Bcl / BAD Peptides | | | Bombesins | | | Bradykinins | | | C-Peptides | | | C3a Peptides | | | Calcitonin Related Peptides | | | Cancer Research Peptides | | | Cardiac Peptides | | | CART (Cocaine- and Amphetamine-Regulated Transcript) Peptides | | | Casomorphin Peptides | | | Caspase Related Peptides | | | CEF Control Peptides | | | Cell Adhesion Peptides | | | Cell Permeable Peptides (CPP) / Drug Delivery Peptides | | | Chemotaxis Peptides | | | Cholecystokinin-Pancreozymin Peptides | | | ClearPoint™-Heavy Isotope Labeled and Related Peptides | | | Corticotropin Related Peptides | | | Cyclic Peptides | | | Cytochromes and Related Peptides | | | Defensins | | | Deltorphin Peptides | | | Dynorphin Peptides | | | Endorphin Peptides | | | Endothelins | | | Enkephalins | | | Enzyme Substrates and Inhibitors | | | Exendins | | | Extracellular Matrix | | | Fibrinogen and Related Peptides | | | Fibronectin Fragments | | | Fluorescent Labeled Peptides | | | FRET Peptides | | | Galanins | | | Gastric Inhibitory Peptides (GIPs) | | | Gastrins | | | Ghrelins and Obestatins | | | Glucagon-Like Peptides | | | Glycopeptides | | | GPCR Peptide Ligands | | | Growth Factors | | | Growth Hormone Related Peptides | | | Hepatitis C Virus (HCV) Related Peptides | | | Histones | | | Guanylins | | | HIV Related Peptides | | | Hydrocarbon-Stapled Peptides | | | Integrins | | | Ion Channel Peptides | | | Kinases/Phosphatase Substrates | | | Luteinizing Hormone-Releasing Hormones and Related Peptides | | | MAPS Peptides | | | Matrix Metalloproteinases (MMPs) | | | Melan-A and Mucin Related Peptides | | | Melanocyte Stimulating Hormones and Analogs | | | MHC related | | | Microbial Peptides | | | Milk Peptides | | | Myelin Oligodendrocyte Glycoprotein (MOG)/Myelin Basic Proteins (MBP) | | | Myosin | | | Natriuretic Peptides | | | Neurokinins | | | Neuromedins | | | Neuropeptide Y and Analogs | | | Neuropeptides | | | Neurotensins and Related Peptides | | | NF-kB/Transcription Factors Related Peptides | | | Opioid Related Peptides | | | Orexins | | | Osteocalcin Fragments | | | OVA Peptides | | | Oxytocins, Vasopressins, and Related Peptides | | | p53 Peptides | | | Pancreatic Polypeptides | | | Parathyroid Hormones and Related Peptides | | | Peptide Aminoluciferin Custom Synthesis For Bioluminescent Assays | | | Peptide Standards | | | Peptide YY and Analogs | | | Peptidoglycan Peptides | | | Phagocytosis | | | Phosphopeptides | | | Phytochelatins | | | Pituitary Adenylate Cyclase Activating Peptides (PACAPS) | | | Prion Protein (PrP) Fragments | | | Prolactin Releasing Peptides | | | Protease Inhibitors | | | Protein Phosphorylation Related Peptides | | | Proteolipid Proteins (PLPs) | | | QA-GSH | | | Renin | | | Retinoid Binding Protein | | | RGD Peptides | | | Saposin Related Peptides | | | Secretins | | | Selectin Related Peptides | | | Signal Transduction Peptides | | | Somatostatins | | | Substance P and Analogs | | | Tag Peptides | | | Tau Peptides | | | Temporins | | | Thrombin Related Peptides | | | Thrombospondins | | | Thyrotropin Releasing Hormones and Related Peptides | | | Toxins | | | Tubulin Peptides | | | Urotensin related peptides | | | Vasoactive Intestinal Peptides (VIPs) | | | Viral Peptides | |
|
 |
|
|
 |
| Product | LL - 37, Antimicrobial Peptide, humanLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
| | CAS | Biotin - YVAD - CMK | | Size | 1 mg | | Catalog # | 61302 | | US$ | 170 | | Hits | |
| Purity |
% Peak Area By HPLC ≥ 95% |
| Description |
Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution. |
| Detailed Information |
 Datasheet |
| Storage |
-20°C |
| References |
Dürr, UHN. et al. Biochim. Biophys. Acta 1758, 1408 (2006); Neville, F. et al. Biophys. J. 90, 1275 (2006); Oren, Z. et al. Biochem. J. 341, 501(1999). |
| Molecular Weight |
4493.3 |
Sequence
(One-Letter Code) |
[LL-37, 37 aa] |
Sequence
(Three-Letter Code) |
H - Leu - Leu - Gly - Asp - Phe - Phe - Arg - Lys - Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg - Asn - Leu - Val - Pro - Arg - Thr - Glu - Ser - OH |
| Product Citations |
Cullen, TW. et al. Infect Immun 81, 430 (2013).
Henningham, A. et al. mBio 4, e00509 (2013).
Moffatt, JH. et al. Infect Immun 81, 684 (2013).
Okumura, CYM. et al. mBio 4, e00499 (2013).
Stover, E. et al. J Amer Soc Hort Sci 138. 142 (2013).
Taneja, NK. et al. J Bacteriol 195, 5102 (2013).
Gilmore, SA. et al. ACS Chem Biol 7, 863. doi: 10.1021/cb200311s (2012).
Hocquellet, A. et al. Peptides 36, 303 (2012).
Love, JF. et al. mBio 3 doi: 10.1128/mBio.00394-12 (2012).
McQuade, R. et al. Anaerobe 286, 18890. doi: 10.1074/jbc.M110.206110 (2012).
Richards, SM. et al. Front Cell Infect Microbiol 2, 102. doi: 10.3389/fcimb.2012.00102 (2012).
Strandberg, KL. et al. Infect Immun doi: 10.1128/IAI.00672-12 (2012).
Sun, Y. et al. J Bacteriol 194, 5274. doi: 10.1128/JB.00045-12 (2012).
Vega, LA. et al. Mol Microbiol 85, 1119. doi: 10.1111/j.1365-2958.2012.08163.x (2012).
Wu, W. et al. Leukemia 26, 736. doi: 10.1038/leu.2011.252 (2012).
Campbell, GR. and SA. Spector JBC 286, 18890. doi: 10.1074/jbc.M110.206110 (2011).
Dean, SN. et al. Front Microbiol 2, 128. doi: 10.3389/fmicb.2011.00128 (2011).
Lebeer, S. et al. Microbial Biotech 4, 368 (2011).
McBride, SM. et al. Microbiol 157, 1457. doi: 10.1099/mic.0.045997-0 (2011).
Sakoulas, G. et al. Antimicrob Agents Chemother 56, 838. doi: 10.1128/AAC.05551-11 (2011).
Sochacki, KA. et al. PNAS 108, E77. doi: 10.1073/pnas.1101130108 (2011).
Subramanian, H. et al. JBC 286, 44739. doi: 10.1074/jbc.M111.277152 (2011).
Amer, L. et al. BBRC 396, 246 (2010).
Cole, JN. et al. mBio 1 doi: 10.1128/mBio.00191-10 (2010).
Gable, JE. et al. Biochem 48, 11264. doi: 10.1021/bi900996q (2009).
Inomata, KA. et al. Eur J Oral Sci 118, 574. doi: 10.1111/j.1600-0722.2010.00775.x (2010).
Into, T. Cell Immunol 264, 104 (2010).
Kanda, N. et al. Hum Immunol 71, 1161 (2010).
Krasnodembskaya, A. et al. Stem Cells doi: 10.1002/stem.544 (2010).
Hocquellet, A. et al. Peptides 155, 2818 (2009).
Kooi, C & PA Sokol, Microbiology 155, 2818 (2009).
Yin, J & FS Yu, ARVO 10.1167/iovs.09-3904 (2009).
Purdy, GE. et al. Mol Microbiol 73, 844. doi: 10.1111/j.1365-2958.2009.06801.x (2009).
Schlamadinger, DE. et al. SPIE Proceedings 7397 doi: 10.1117/12.827439 (2009).
Lee, HM. et al. Leukemia 23, 2052. doi:10.1038/leu.2009.158 (2009).
Bourbon, C. et al. Anal Biochem 381, 279 (2008). |
|
|